Overview

  • Product name
    Anti-Zfp275 antibody
  • Description
    Rabbit polyclonal to Zfp275
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 350-399 (

    LAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKA

    ) of Mouse Zfp275 (NP_113682).

  • Positive control
    • Mouse kidney lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Constituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab116080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Zfp275 antibody images

  • Anti-Zfp275 antibody (ab116080) at 1 µg/ml + Mouse kidney lysate at 10 µg

    Predicted band size : 52 kDa

References for Anti-Zfp275 antibody (ab116080)

ab116080 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up