
  • Product name
    Anti-ZFP62 antibody
  • Description
    Rabbit polyclonal to ZFP62
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 70-120 (TGEKPYECDICGKTFSNSSGLRVHKRIHTGEKPYECDECGKAFITCRTL L) of Human ZFP62 (Q8NB50)

  • Positive control
    • 293T cell lysate



Our Abpromise guarantee covers the use of ab86680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-ZFP62 antibody images

  • Anti-ZFP62 antibody (ab86680) at 1 µg/ml + 293T cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 79 kDa
    Observed band size : 79 kDa

References for Anti-ZFP62 antibody (ab86680)

ab86680 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86680.
Please use the links above to contact us or submit feedback about this product.


Sign up