Anti-ZFP92 antibody - N-terminal (ab180242)

Overview

  • Product name
    Anti-ZFP92 antibody - N-terminal
  • Description
    Rabbit polyclonal to ZFP92 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human ZFP92 aa 51-80 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    VSLGFSFSKPHLISQLERGEGPWVADIPRT


    Database link: A6NM28

  • Positive control
    • Human uterus tissue lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab180242 is purified through a protein A column, followed by peptide affinity purification.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 46 kDa.

Target

  • Relevance
    ZFP92 belongs to the krueppel C2H2-type zinc-finger protein family. It contains eight C2H2-type zinc fingers and one KRAB domain. ZFP92 may be involved in transcriptional regulation.
  • Cellular localization
    Nucleus
  • Database links
  • Alternative names
    • Zfp 92 antibody
    • Zinc finger protein homologous to Zfp92 in mouse antibody

Images

  • Anti-ZFP92 antibody - N-terminal (ab180242) at 1/1000 dilution + Human uterus tissue lysate at 35 µg

    Predicted band size: 46 kDa

References

ab180242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up