Overview

  • Product name
    Anti-ZFYVE26 antibody
  • Description
    Rabbit polyclonal to ZFYVE26
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ZFYVE26 aa 1887-1975.
    Sequence:

    DSSKNESPPYSFVVRVPKADEVEWILDLKEEENELVRSEFYYEQAPSASL CIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLL


    Database link: Q68DK2

  • Positive control
    • Human cerebral cortex, skin, liver cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Phosphatidylinositol 3-phosphate-binding protein required for the abcission step in cytokinesis: recruited to the midbody during cytokinesis and acts as a regulator of abcission. May also be required for efficient homologous recombination DNA double-strand break repair.
  • Tissue specificity
    Strongest expression in the adrenal gland, bone marrow, adult brain, fetal brain, lung, placenta, prostate, skeletal muscle, testis, thymus, and retina. Intermediate levels are detected in other structures, including the spinal cord.
  • Involvement in disease
    Spastic paraplegia 15, autosomal recessive
  • Sequence similarities
    Contains 1 FYVE-type zinc finger.
  • Domain
    The FYVE-type zinc finger mediates binding to phosphatidylinositol 3-phosphate and recruitment to the midbody during cytokinesis.
  • Cellular localization
    Cytoplasm > cytoskeleton > microtubule organizing center > centrosome. Midbody. Localizes to the centrosome during all stages of the cell cycle. Recruited to the midbody during cytokinesis by KIF13A.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp686F19106 antibody
    • DKFZp781H1112 antibody
    • FYVE domain-containing centrosomal protein antibody
    • FYVE-CENT antibody
    • KIAA0321 antibody
    • Spastic paraplegia 15 (complicated autosomal recessive) antibody
    • Spastizin antibody
    • SPG15 antibody
    • ZFY26_HUMAN antibody
    • ZFYVE 26 antibody
    • ZFYVE26 antibody
    • Zinc finger FYVE domain containing 26 antibody
    • Zinc finger FYVE domain containing protein 26 antibody
    • Zinc finger FYVE domain-containing protein 26 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed paraffin embedded human cerebral cortex labeling ZFYVE26 with ab188143 at 1/50 dilution

  • Immunohistochemical analysis of formalin fixed paraffin embedded human skin labeling ZFYVE26 with ab188143 at 1/50 dilution

  • Immunohistochemical analysis of formalin fixed paraffin embedded human liver cancer labeling ZFYVE26 with ab188143 at 1/50 dilution

References

ab188143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up