Overview

  • Product name
  • Description
    Rabbit polyclonal to ZIK1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 318-367 (KRVHTGERPYKCSECGNSFSQSAILNQHRRIHTGVKPYECRECGKSFSQ K) of Mouse ZIK1 (NP_033603).

  • Positive control
    • Mouse kidney lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Constituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May be a transcriptional repressor.
  • Tissue specificity
    Expressed at high levels in gastric glands, and at low levels in colon and small intestine. Silenced through promoter methylation in gastric glands with intestinal metaplasia.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 9 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ZIK1 antibody
    • ZIK1_HUMAN antibody
    • Zinc finger protein 762 antibody
    • Zinc finger protein interacting with K protein 1 antibody
    • Zinc finger protein interacting with ribonucleoprotein K antibody
    see all

Anti-ZIK1 antibody images

  • Anti-ZIK1 antibody (ab122961) at 1 µg/ml + Mouse kidney lysate at 10 µg

    Predicted band size : 53 kDa

References for Anti-ZIK1 antibody (ab122961)

ab122961 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up