
  • Product name
  • Description
    Rabbit polyclonal to ZIK1
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 318-367 (KRVHTGERPYKCSECGNSFSQSAILNQHRRIHTGVKPYECRECGKSFSQ K) of Mouse ZIK1 (NP_033603).

  • Positive control
    • Mouse kidney lysate.


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Constituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab122961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    May be a transcriptional repressor.
  • Tissue specificity
    Expressed at high levels in gastric glands, and at low levels in colon and small intestine. Silenced through promoter methylation in gastric glands with intestinal metaplasia.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 9 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • ZIK1 antibody
    • ZIK1_HUMAN antibody
    • Zinc finger protein 762 antibody
    • Zinc finger protein interacting with K protein 1 antibody
    • Zinc finger protein interacting with ribonucleoprotein K antibody
    see all


  • Anti-ZIK1 antibody (ab122961) at 1 µg/ml + Mouse kidney lysate at 10 µg

    Predicted band size: 53 kDa

    Gel concentration: 12%


ab122961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122961.
Please use the links above to contact us or submit feedback about this product.


Sign up