Anti-Zinc finger protein 251 antibody (ab85493)

Overview

  • Product name
    Anti-Zinc finger protein 251 antibody
    See all Zinc finger protein 251 primary antibodies
  • Description
    Rabbit polyclonal to Zinc finger protein 251
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 180-229 (

    GKELWVLNLLGAEEPDILKSCQKDSEVGTKKELSILNQKFSEEVKTPEFV

    ) of human Zinc finger protein 251 (XP_942907).

  • Positive control
    • Human fetal muscle lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    Purified by peptide affinity chromatography method.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Zinc finger protein 251 antibody images

  • Anti-Zinc finger protein 251 antibody (ab85493) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 71 kDa
    Observed band size : 71 kDa
    Additional bands at : 51 kDa. We are unsure as to the identity of these extra bands.

References for Anti-Zinc finger protein 251 antibody (ab85493)

ab85493 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85493.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up