Anti-Zinc finger protein 30 antibody (ab85411)


  • Product nameAnti-Zinc finger protein 30 antibody
  • Description
    Rabbit polyclonal to Zinc finger protein 30
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 287-336 (YECKECGKAFSTSSPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQS I) of Human Zinc finger protein 30 (NP_919306).

  • Positive control
    • Hela Cell lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab85411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 62 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • RelevanceZinc finger protein 30 may be involved in transcriptional regulation.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • DKFZp686N19164 antibody
    • FLJ20562 antibody
    • KOX28 antibody
    • Zinc finger protein 30 (KOX 28) antibody
    • Zinc finger protein 30 antibody
    • Zinc finger protein KOX28 antibody
    see all

Anti-Zinc finger protein 30 antibody images

  • Anti-Zinc finger protein 30 antibody (ab85411) at 1 µg/ml + HeLa cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size : 62 kDa
    Observed band size : 65 kDa (why is the actual band size different from the predicted?)
    Additional bands at : >90 kDa. We are unsure as to the identity of these extra bands.

References for Anti-Zinc finger protein 30 antibody (ab85411)

ab85411 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85411.
Please use the links above to contact us or submit feedback about this product.