Anti-zinc finger protein 655 antibody - N-terminal (ab182267)

Overview

  • Product name
    Anti-zinc finger protein 655 antibody - N-terminal
    See all zinc finger protein 655 primary antibodies
  • Description
    Rabbit polyclonal to zinc finger protein 655 - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Cat, Dog
  • Immunogen

    Synthetic peptide within Human zinc finger protein 655 aa 115-164 (N terminal). The exact sequence is proprietary.
    Sequence:

    QITISKETFTSEKNNECHEPEKSFSLDSTIDADQRVLRIQNTDDNDKYDM


    Database link: Q8N720

  • Positive control
    • HepG2 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa.

Target

  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp686M1631 antibody
    • FLJ23461 antibody
    • MGC10859 antibody
    • MGC16203 antibody
    • MGC5521 antibody
    • Vav 1 interacting Kruppel like protein antibody
    • Vav interacting Krueppel like protein antibody
    • Vav-interacting Krueppel-like protein antibody
    • VIK 1 antibody
    • VIK antibody
    • VIK1 antibody
    • Zinc finger protein 655 antibody
    • ZN655_HUMAN antibody
    • ZNF655 antibody
    see all

Images

  • Anti-zinc finger protein 655 antibody - N-terminal (ab182267) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 57 kDa

References

ab182267 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up