Anti-Zinc finger protein 709 antibody (ab66389)

Overview

  • Product nameAnti-Zinc finger protein 709 antibody
    See all Zinc finger protein 709 primary antibodies
  • Description
    Rabbit polyclonal to Zinc finger protein 709
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Dog
  • Immunogen

    Synthetic peptide corresponding to Human Zinc finger protein 709 aa 61-110 (N terminal).
    Sequence:

    KLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKD


    Database link: Q8N972

  • Positive control
    • Jurkat cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityProtein A purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab66389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 75 kDa (predicted molecular weight: 75 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/312500.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 19 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 9530015I07Rik antibody
    • mCG_22830 antibody
    • Zinc finger protein 709 antibody
    • zinc finger protein 872 antibody
    • ZN709_HUMAN antibody
    • ZNF709 antibody
    see all

Anti-Zinc finger protein 709 antibody images

  • All lanes : Anti-Zinc finger protein 709 antibody (ab66389) at 2.5 µg/ml

    Lane 1 : Molecular weight markers
    Lane 2 : Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 75 kDa
    Observed band size : 75 kDa
    Additional bands at : 87 kDa. We are unsure as to the identity of these extra bands.
    Gel concentration: 12%.

References for Anti-Zinc finger protein 709 antibody (ab66389)

ab66389 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab66389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"