Overview

  • Product nameAnti-ZKSCAN1 antibody
    See all ZKSCAN1 primary antibodies
  • Description
    Rabbit polyclonal to ZKSCAN1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    A Synthetic peptide corresponding to a region within C terminal amino acids 386 - 435 (

    YECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRI

    ) of Mouse ZKSCAN1 (NP_084145).

  • Positive control
    • Mouse heart lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab113988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
    Contains 1 SCAN box domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 9130423L19Rik antibody
    • KOX18 antibody
    • MGC138429 antibody
    • MGC63357 antibody
    • OTTHUMP00000210080 antibody
    • PHZ 37 antibody
    • PHZ-37 antibody
    • Zinc finger protein 139 antibody
    • Zinc finger protein 36 (KOX 18) antibody
    • Zinc finger protein 36 antibody
    • Zinc finger protein KOX18 antibody
    • Zinc finger protein with KRAB and SCAN domains 1 antibody
    • ZKSC1_HUMAN antibody
    • ZKSCAN1 antibody
    • ZNF139 antibody
    • ZNF36 antibody
    see all

Anti-ZKSCAN1 antibody images

  • Anti-ZKSCAN1 antibody (ab113988) at 1 µg/ml + Mouse heart lysate at 10 µg

    Predicted band size : 55 kDa

References for Anti-ZKSCAN1 antibody (ab113988)

ab113988 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"