Overview

  • Product name
  • Description
    Rabbit polyclonal to ZKSCAN3
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZKSCAN3 aa 151-300.
    Sequence:

    LLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPVLAHGGCCREDK VVASRLTPESQGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLV SLGDEKQTKSRDLPPAEELPEKEHGKISCHLREDIAQIPTCAEAGEQEGR


    Database link: Q9BRR0

  • Positive control
    • Human tonsil tissue; Human cell A-431 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function
    Acts as a transcriptional regulator. Binds to the consensus sequence 5'-[GT][AG][AGT]GGGG-3'. Associates with chromatin at the ITGB4 and VEGF promoters. Activates the transcription of genes associated with colon cancer progression.
  • Tissue specificity
    Expressed in colorectal cancers (at protein level).
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 7 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
    Contains 1 SCAN box domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • dJ874C20.1 antibody
    • mszf35 antibody
    • SCAN-KRAB-zinc finger protein antibody
    • Skz1 antibody
    • Zf47 antibody
    • Zfp-47 antibody
    • ZFP306 antibody
    • Zfp307 antibody
    • Zfp47 antibody
    • Zinc finger and SCAN domain containing protein 13 antibody
    • Zinc finger and SCAN domain-containing protein 13 antibody
    • Zinc finger protein 306 antibody
    • Zinc finger protein 306, isoform CRA_a antibody
    • Zinc finger protein 307 antibody
    • Zinc finger protein 309 antibody
    • Zinc finger protein 47 homolog antibody
    • Zinc finger protein with KRAB and SCAN domains 3 antibody
    • Zinc finger protein with KRAB and SCAN domains 3 antibody
    • Zinc finger protein zfp47 antibody
    • Zinc finger with KRAB and SCAN domains 3 antibody
    • ZKSC3_HUMAN antibody
    • ZKSCAN3 antibody
    • ZNF309 antibody
    • ZSCAN13 antibody
    • ZSCAN35 antibody
    see all

Images

  • Immunofluorescent analysis of Human cell line A-431 labeling ZKSCAN3 with ab187866 at 4µg/ml. 

  • Immunohistochemistry analysis of formalin/PFA-fixed paraffin-embedded Human tonsil tissue labeling ZKSCAN3 with ab187866 at 1/50 dilution. 

References

ab187866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up