Overview

  • Product nameAnti-Zmat2 antibody
    See all Zmat2 primary antibodies
  • Description
    Rabbit polyclonal to Zmat2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 174-199 (KEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY) of Human Zmat2 (NP_653324).

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab108076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Zmat2 antibody images

  • Anti-Zmat2 antibody (ab108076) at 1 µg/ml + 721_B cell lysate at 10 µg

    Predicted band size : 24 kDa

References for Anti-Zmat2 antibody (ab108076)

ab108076 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"