Overview

  • Product nameAnti-ZNF131 antibody
    See all ZNF131 primary antibodies
  • Description
    Rabbit polyclonal to ZNF131
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide designed within residues:

    AAEFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITES

    , corresponding to N terminal amino acids 107-156 of Human ZNF131

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab80844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay 1/62500.

Target

  • FunctionMay be involved in transcriptional regulation. Plays a role during development and organogenesis as well as in the function of the adult central nervous system.
  • Tissue specificityPredominant expression is found in different brain areas such as the occipital and temporal lobe, the nucleus caudatus, hippocampus, and the cerebellum as well as in testis and thymus.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 1 BTB (POZ) domain.
    Contains 6 C2H2-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • pHZ 10 antibody
    • pHZ10 antibody
    • Zinc finger protein 131 antibody
    • ZN131_HUMAN antibody
    • ZNF 131 antibody
    • Znf131 antibody
    see all

Anti-ZNF131 antibody images

  • Anti-ZNF131 antibody (ab80844) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 71 kDa
    Observed band size : 60 kDa (why is the actual band size different from the predicted?)

References for Anti-ZNF131 antibody (ab80844)

ab80844 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab80844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"