Overview

  • Product name
    Anti-ZNF154 antibody
  • Description
    Rabbit polyclonal to ZNF154
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (

    RCLYRDVMLENLALLTSLDVHHQKQHLGEKHFRSNVGRALFVKTCTFHVS

    ) of Human ZNF154 (NP_001078853).

  • Positive control
    • Human fetal brain lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab87160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 12 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • KIAA2003 antibody
    • MGC176628 antibody
    • MGC176661 antibody
    • pHZ 92 antibody
    • pHZ92 antibody
    • Zinc finger protein 154 (pHZ 92) antibody
    • Zinc finger protein 154 (pHZ92) antibody
    • Zinc finger protein 154 antibody
    • ZN154_HUMAN antibody
    • ZNF154 antibody
    see all

Anti-ZNF154 antibody images

  • Anti-ZNF154 antibody (ab87160) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 50 kDa
    Observed band size : 50 kDa

References for Anti-ZNF154 antibody (ab87160)

ab87160 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up