Overview

  • Product nameAnti-ZNF165 antibody
    See all ZNF165 primary antibodies
  • Description
    Rabbit polyclonal to ZNF165
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 216-265 of Human ZNF165;

    ISEASGESQDICKSAGRVKRQWEKESGESQRLSSAQDEGFGKILTHKNTV

    ; NP_003438

  • Positive control
    • HeLa cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab86360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 56 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Tissue specificityExpressed specifically in testis.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
    Contains 1 SCAN box domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cancer/testis antigen 53 antibody
    • CT53 antibody
    • LD65 antibody
    • MGC140342 antibody
    • OTTHUMP00000016195 antibody
    • Zinc finger and SCAN domain containing protein 7 antibody
    • Zinc finger and SCAN domain-containing protein 7 antibody
    • Zinc finger protein 165 antibody
    • ZINC FINGER PROTEIN 165; ZNF165 antibody
    • ZN165_HUMAN antibody
    • ZNF165 antibody
    • ZPF165 antibody
    • ZSCAN7 antibody
    see all

Anti-ZNF165 antibody images

  • Anti-ZNF165 antibody (ab86360) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 56 kDa
    Observed band size : 56 kDa
    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling ZNF165 with ab86360 at 5.0µg/ml.

References for Anti-ZNF165 antibody (ab86360)

ab86360 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Loading amount 10 µg
Gel Running Conditions Reduced Denaturing (10%)
Sample Human Cell lysate - whole cell (breast cancer cell line)
Specification breast cancer cell line
Treatment siZNF165 for 72hrs
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Username

Ms. Jennifer Macion

Verified customer

Submitted Mar 13 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"