Overview

  • Product nameAnti-ZNF169 antibody
    See all ZNF169 primary antibodies
  • Description
    Rabbit polyclonal to ZNF169
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 71-120 (

    EPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIF

    ) of Human ZNF169 (NP_919301).

  • Positive control
    • Human fetal kidney cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceZNF169 belongs to the krueppel C2H2 type zinc finger protein family. It may be involved in transcriptional regulation. It is highly expressed in kidney, weakly expressed in heart, liver, spleen, and small intestine. Not expressed in adult brain or spinal cord. ZNF169 contains thirteen C2H2 type zinc fingers and one KRAB domain.
  • Cellular localizationNucleus
  • Database links
  • Alternative names
    • MGC51961 antibody
    • Zfp169 antibody
    • Zinc finger protein 169 antibody
    • Znf169 antibody

Anti-ZNF169 antibody images

  • Anti-ZNF169 antibody (ab98918) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    Predicted band size : 68 kDa

References for Anti-ZNF169 antibody (ab98918)

ab98918 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"