Overview

  • Product nameAnti-ZNF180 antibody
    See all ZNF180 primary antibodies
  • Description
    Rabbit polyclonal to ZNF180
  • Tested applicationsSuitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 287 - 336 (LHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSH S) of Human zinc finger protein 180 (NP_037388)

  • Positive control
    • 293T cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab82965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 12 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • HHZ168 antibody
    • Zinc finger protein 180 antibody
    • Zinc finger protein 180 HHZ168 antibody
    • ZN180_HUMAN antibody
    • ZNF180 antibody
    see all

Anti-ZNF180 antibody images

  • Anti-ZNF180 antibody (ab82965) at 1 µg/ml + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 79 kDa
    Observed band size : 79 kDa

References for Anti-ZNF180 antibody (ab82965)

ab82965 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"