Overview

  • Product name
  • Description
    Mouse polyclonal to ZNF19
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human ZNF19 aa 1-458. ( AAH47091.1)
    Sequence:

    MAAMPLKAQYQEMVTFEDVAVHFTKTEWTGLSPVQRALYRSVMLENFGNL TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE STLIQGISEERDGMMSHGQLKSVPQRTDFPETRNVEKHQDIPTVKNIQGK VPRIPCARKPFICEECGKSFSYFSYYARHQRIHTGEKPFECSECGKAFNG NSSLIRHQRIHTGERPYHCEECGRAFNDNANLIRHQRIHSGDRPYYCTEC GNSFTSSSEFVIHQRIHTGEKPYECNECGKAFVGNSPLLRHQKIHTGEKP YECNECGKSFGRTSHLSQHQRIHTGEKPYSCKVCGQAFNFHTKLTRHQRI HSEEKPFDCVDCGKAFSAQEQLKRHLRIHTQESSYVCDECGKALTSKRNL HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP EFFTPFYW


    Database link: P17023

  • Positive control
    • ZNF19 transfected 293T cell line lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 52 kDa.

Target

  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 10 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • KOX12 antibody
    • zinc finger protein 19 (KOX 12) antibody
    • Zinc finger protein 19 antibody
    • Zinc finger protein KOX12 antibody
    • ZNF19 antibody
    • ZNF19_HUMAN antibody
    see all

Images

  • All lanes : Anti-ZNF19 antibody (ab172121) at 1/500 dilution

    Lane 1 : ZNF19 transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 52 kDa

References

ab172121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up