Overview

  • Product name
    Anti-ZNF236 antibody
  • Description
    Rabbit polyclonal to ZNF236
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    A synthetic peptide corresponding to a region within the internal sequence 1079-1128 (

    VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ

    ) of Human ZNF236, NP_031371

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab85453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 168 kDa (predicted molecular weight: 207 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    ZNF236 belongs to the krueppel C2H2-type zinc-finger protein family. It contains thirty C2H2-type zinc fingers. ZNF236 may be involved in transcriptional regulation. Ubiquitous. Expression levels are highest in skeletal muscle and brain, intermediate in heart, pancreas, and placenta, and lowest in kidney, liver, and lung. There are two named isoforms.
  • Cellular localization
    Nucleus
  • Database links
  • Alternative names
    • Regulated by glucose antibody
    • Zinc finger protein 236 antibody
    • ZNF236A antibody
    • ZNF236B antibody

Images

  • Anti-ZNF236 antibody (ab85453) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 207 kDa
    Observed band size : 168 kDa (why is the actual band size different from the predicted?)

References

ab85453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up