Overview

  • Product nameAnti-ZNF248 antibody
    See all ZNF248 primary antibodies
  • Description
    Rabbit polyclonal to ZNF248
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region from N-terminal amino acids 108-157 (

    NKTVSVENGDRGSKTFNLGTDPVSLRNYPYKICDSCEMNLKNISGLIISK

    ) of human ZNF248 (NP_066383)

  • Positive control
    • HepG2 Cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab85291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 8 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • bA162G10.3 (zinc finger protein) antibody
    • bA162G10.3 antibody
    • KIAA0137 antibody
    • KRAB protein domain antibody
    • Kruppel-type zinc finger protein antibody
    • MGC131882 antibody
    • OTTHUMP00000019462 antibody
    • OTTHUMP00000019463 antibody
    • OTTHUMP00000019464 antibody
    • Zinc finger protein 248 antibody
    • ZN248_HUMAN antibody
    • ZNF248 antibody
    see all

Anti-ZNF248 antibody images

References for Anti-ZNF248 antibody (ab85291)

ab85291 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"