Overview

  • Product nameAnti-ZNF252 antibody
  • Description
    Rabbit polyclonal to ZNF252
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 338 - 387 (

    AFSTQLFLIQHQRIHTGEKPYECNECAKSFSLNRTLTVHQRIHTGEKPYR

    ) of Human ZNF252 (SwissProt id: Q8WUN3)

  • Positive control
    • Jurkat cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab86533 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceZNF252 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 18 C2H2-type zinc fingers. ZNF252 may be involved in transcriptional regulation.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • zinc finger protein 252 antibody

Anti-ZNF252 antibody images

  • Anti-ZNF252 antibody (ab86533) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 79 kDa

References for Anti-ZNF252 antibody (ab86533)

ab86533 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your inquiry. We do have a positive control WB image for ab86533 and it's at the bottom of the online datasheet. http://www.abcam.com/ZNF252-antibody-ab86533.html#ZNF252-Primary-antibodies-ab86533-1.jpg If you're looking for Jurkat cell l...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"