Overview

  • Product name
    Anti-ZNF264 antibody
  • Description
    Rabbit polyclonal to ZNF264
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF264 aa 1-220.
    Sequence:

    MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLL VSLGCPVPKAELICHLEHGQEPWTRKEDLSQDTCPGDKGKPKTTEPTTCE PALSEGISLQGQVTQGNSVDSQLGQAEDQDGLSEMQEGHFRPGIDPQEKS PGKMSPECDGLGTADGVCSRIGQEQVSPGDRVRSHNSCESGKDPMIQEEE NNFKCSECGKVFNKKHLLAG


    Database link: O43296

  • Positive control
    • WB: Jurkat and HEK-293T whole cell lysate. IHC-P: Human brain and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab225930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 19, 71 kDa (predicted molecular weight: 71 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function
    May be involved in transcriptional regulation.
  • Tissue specificity
    Relatively highly expressed in kidney, thymus, testis, ovary, brain, lung, placenta, and prostate, and relatively low expression in heart, liver, skeletal muscle, pancreas, spleen, and small intestine.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 13 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • KIAA0412 antibody
    • Zinc finger protein 264 antibody
    • ZN264_HUMAN antibody
    • ZNF264 antibody

Images

  • Paraffin embedded human testis tissue stained for ZNF264 with ab225930 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human brain tissue stained for ZNF264 with ab225930 (1/100 dilution) in immunohistochemical analysis.

References

ab225930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up