Overview

  • Product nameAnti-ZNF277 antibody
    See all ZNF277 primary antibodies
  • Description
    Rabbit polyclonal to ZNF277
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGT T ) of Human ZNF277 (NP_068834).

  • Positive control
    • OVCAR-3 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab108075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the ZNF277 family.
    Contains 2 C2H2-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • NRIF 4 antibody
    • NRIF4 antibody
    • Nuclear receptor interacting factor 4 antibody
    • Nuclear receptor-interacting factor 4 antibody
    • Zinc finger protein (C2H2 type) 277 antibody
    • Zinc finger protein 277 antibody
    • Zinc finger protein 277 pseudogene antibody
    • ZN277_HUMAN antibody
    • ZNF 277 antibody
    • ZNF277 antibody
    • ZNF277P antibody
    see all

Anti-ZNF277 antibody images

  • Anti-ZNF277 antibody (ab108075) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg

    Predicted band size : 53 kDa

References for Anti-ZNF277 antibody (ab108075)

ab108075 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108075.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"