
  • Product name
  • Description
    Rabbit polyclonal to ZNF277
  • Host species
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGT T ) of Human ZNF277 (NP_068834).

  • Positive control
    • OVCAR-3 cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab108075 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the ZNF277 family.
    Contains 2 C2H2-type zinc fingers.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • NRIF 4 antibody
    • NRIF4 antibody
    • Nuclear receptor interacting factor 4 antibody
    • Nuclear receptor-interacting factor 4 antibody
    • Zinc finger protein (C2H2 type) 277 antibody
    • Zinc finger protein 277 antibody
    • Zinc finger protein 277 pseudogene antibody
    • ZN277_HUMAN antibody
    • ZNF 277 antibody
    • ZNF277 antibody
    • ZNF277P antibody
    see all


  • Anti-ZNF277 antibody (ab108075) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg

    Predicted band size: 53 kDa

    Gel concentration 12%


ab108075 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108075.
Please use the links above to contact us or submit feedback about this product.


Sign up