Overview

  • Product nameAnti-ZNF302 antibody
    See all ZNF302 primary antibodies
  • Description
    Rabbit polyclonal to ZNF302
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Guinea pig, Cow, Cat, Dog, Chimpanzee, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 288-337 (

    MNCGKSFSRVSLLIQHLRIHTQEKRYECRICGKAFIHSSSLIHHQKSHTG

    ) of Human ZNF302 (NP_060913).

  • Positive control
    • Human fetal small intestine lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 7 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • HSD16 antibody
    • MST154 antibody
    • MSTP154 antibody
    • Zinc finger protein 135-like antibody
    • Zinc finger protein 140-like antibody
    • Zinc finger protein 302 antibody
    • Zinc finger protein 327 antibody
    • Zinc finger ZNF140 like antibody
    • ZN302_HUMAN antibody
    • ZNF135 like antibody
    • ZNF135L antibody
    • ZNF140 like antibody
    • ZNF140L antibody
    • ZNF302 antibody
    • ZNF327 antibody
    see all

Anti-ZNF302 antibody images

  • Anti-ZNF302 antibody (ab94663) at 1 µg/ml + Human fetal small intestine lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 55 kDa

References for Anti-ZNF302 antibody (ab94663)

ab94663 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"