Overview

  • Product nameAnti-ZNF318 antibody
  • Description
    Rabbit polyclonal to ZNF318
  • Tested applicationsSuitable for: IHC-P, WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human ZNF318 aa 190-239. The exact sequence is proprietary.
    Sequence:

    SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH


    Database link: Q5VUA4

  • Positive control
    • Fetal Stomach Lysate, human pancreas.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab30972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 232 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/62500.

Target

  • RelevanceZNF318 encodes a nuclear protein with a zinc finger motif of the Cys2-His2 type that is a novel corepressor of androgen receptor.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • Endocrine Regulatory Protein antibody
    • HGNC13578 antibody
    • HRIHFB2436 antibody
    • ZFP318 antibody
    • Zinc Finger Protein 318 antibody
    see all

Anti-ZNF318 antibody images

  • Anti-ZNF318 antibody (ab30972) at 0.5 µg/ml (in 5% skim milk / PBS buffer) + fetal stomac lysate

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 232 kDa
    Observed band size : >116 kDa (why is the actual band size different from the predicted?)
    Additional bands at : <45 kDa. We are unsure as to the identity of these extra bands.
  • Immunohistochemical analysis of ZNF318 expression in paraffin embedded human pancreas tissue section, using 4 µg/ml ab30972. Arrows indicate positively labelled epithelial cells of pancreatic acinus.
  • Immunohistochemistry of Human Pancreas lysate tissue at an antibody concentration of 4-8µg/ml using anti-ZNF318 antibody (ab30972)

References for Anti-ZNF318 antibody (ab30972)

ab30972 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab30972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"