Overview

  • Product name
    Anti-ZNF341 antibody
  • Description
    Rabbit polyclonal to ZNF341
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow, Dog
  • Immunogen

    Synthetic peptide within Human ZNF341 aa 426-475 (internal sequence). The exact sequence is proprietary.
    Sequence:

    GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC


    Database link: Q9BYN7

  • Positive control
    • WB: HepG2 cell lysate. IHC-P: human intestine.

Properties

Applications

Our Abpromise guarantee covers the use of ab28485 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 82 kDa (predicted molecular weight: 92 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/312500.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Relevance
    ZNF341 belongs to the krueppel C2H2 type zinc finger protein family. It may be involved in transcriptional regulation.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • Zfp341 antibody
    • Zinc finger protein 341 antibody

Images

  • Ab28485, at a dilution of 4 - 8 µg/ml, staining paraffin embedded human intestine tissue sections by Immunohistochemistry. Cells with positive label (epithilial cells of intestinal villus) are indicated with arrows.
    Magnification: 400X.
  • Anti-ZNF341 antibody (ab28485) at 0.5 µg/ml + HepG2 cell lysate at 10 µg/ml

    Secondary
    HRP conjugated anti Rabbit IgG

    Predicted band size: 92 kDa
    Observed band size: 52,82 kDa (why is the actual band size different from the predicted?)



    Gel concentration: 12%.

References

ab28485 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab28485.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up