Overview

  • Product nameAnti-ZNF366 antibody
    See all ZNF366 primary antibodies
  • Description
    Rabbit polyclonal to ZNF366
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 684-733 (GAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLE R) of Human ZNF366 (NP_689838).

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 85 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionHas transcriptional repression activity. Acts as corepressor of ESR1; the function seems to involve CTBP1 and histone deacetylases.
  • Sequence similaritiesContains 11 C2H2-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DC-SCRIPT antibody
    • DCSCRIPT antibody
    • Dendritic cell specific transcript antibody
    • FLJ39796 antibody
    • MGC99415 antibody
    • Zfp366 antibody
    • Zfp366 zinc finger protein 366 antibody
    • Zinc finger protein 366 antibody
    • ZN366_HUMAN antibody
    • ZNF366 antibody
    see all

Anti-ZNF366 antibody images

  • Anti-ZNF366 antibody (ab87173) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 85 kDa
    Observed band size : 85 kDa

References for Anti-ZNF366 antibody (ab87173)

ab87173 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"