Overview

  • Product nameAnti-ZNF382 antibody
  • Description
    Rabbit polyclonal to ZNF382
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human ZNF382 aa 1-50 (N terminal).
    Sequence:

    MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHM

  • Positive control
    • Jurkat cell lysate.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab51276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 59 kDa (predicted molecular weight: 64 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/1562500.

Target

Anti-ZNF382 antibody images

  • Anti-ZNF382 antibody (ab51276) at 1.25 µg/ml + Jurkat Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 64 kDa
    Observed band size : 59 kDa (why is the actual band size different from the predicted?)

References for Anti-ZNF382 antibody (ab51276)

ab51276 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab51276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"