Overview

  • Product nameAnti-ZNF391 antibody
    See all ZNF391 primary antibodies
  • Description
    Rabbit polyclonal to ZNF391
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 73-122 QQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSD of Human ZNF391, NP_001070249

  • Positive control
    • 721_B cells lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:62500.

Target

  • RelevanceMay be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • dJ153G14.3 antibody
    • RP1-153G14.3 antibody
    • Zinc finger protein 391 antibody

Anti-ZNF391 antibody images

  • Anti-ZNF391 antibody (ab81370) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 40 kDa
    Observed band size : 40 kDa

References for Anti-ZNF391 antibody (ab81370)

ab81370 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"