
  • Product name
    Anti-ZNF391 antibody
  • Description
    Rabbit polyclonal to ZNF391
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 73-122 QQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSD of Human ZNF391, NP_001070249

  • Positive control
    • 721_B cells lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab81370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:62500.


  • Relevance
    May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.
  • Cellular localization
  • Database links
  • Alternative names
    • dJ153G14.3 antibody
    • RP1-153G14.3 antibody
    • Zinc finger protein 391 antibody

Anti-ZNF391 antibody images

  • Anti-ZNF391 antibody (ab81370) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 40 kDa
    Observed band size : 40 kDa

References for Anti-ZNF391 antibody (ab81370)

ab81370 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81370.
Please use the links above to contact us or submit feedback about this product.


Sign up