Overview

  • Product nameAnti-ZNF415 antibody
    See all ZNF415 primary antibodies
  • Description
    Rabbit polyclonal to ZNF415
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 3 - 52 (

    AFTQLTFRDVAIEFSQDEWKCLNSTQRTLYRDVMLENYRNLVSLDLSRNC

    ) of Human ZNF415 (NP_060825)

  • Positive control
    • 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab86395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 69 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionInvolved in transcriptional regulation. Transcriptional activity differed among the various isoforms. All isoforms except isoform 3 seem to suppresses the transcriptional activities of AP-1 and p53/TP53.
  • Tissue specificityExpressed in all tissues examined. Isoforms are differentially expressed. Isoform 3 and isoform 5 were highly expressed, isoform 4 moderately expressed, isoform 2 lower expression, the lowest expression level was seem with isoform 1.
  • Sequence similaritiesContains 12 C2H2-type zinc fingers.
  • Cellular localizationNucleus. Cytoplasm. Isoforms 1, isoform 2, isoform 4 and isoform 5 showed both nuclear and cytoplasm localization. Isoform 3 localized only to nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ11191 antibody
    • Zinc finger protein 415 antibody
    • ZN415_HUMAN antibody
    • ZNF415 antibody
    • ZNF415 zinc finger protein 415 antibody
    see all

Anti-ZNF415 antibody images

  • Anti-ZNF415 antibody (ab86395) at 1 µg/ml + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 69 kDa
    Observed band size : 65 kDa (why is the actual band size different from the predicted?)
    Additional bands at : <60 kDa. We are unsure as to the identity of these extra bands.

References for Anti-ZNF415 antibody (ab86395)

ab86395 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"