Overview

  • Product nameAnti-ZNF431 antibody
  • Description
    Rabbit polyclonal to ZNF431
  • Tested applicationsSuitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 2 - 51 (

    DDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWEC

    ) of Human ZNF431 (NP_597730)

  • Positive control
    • HeLa cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab87232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IP Use at an assay dependent dilution. PubMed: 21177534

Target

  • RelevanceZNF431 belongs to the krueppel C2H2-type zinc-finger protein family and is probably involved in transcriptional regulation.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • DKFZp313E0830 antibody
    • KIAA1969 antibody
    • Zinc finger protein 431 antibody
    • ZNF431 zinc finger protein 431 antibody

Anti-ZNF431 antibody images

  • Anti-ZNF431 antibody (ab87232) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 67 kDa

References for Anti-ZNF431 antibody (ab87232)

This product has been referenced in:
  • He Z  et al. A Novel KRAB Domain-containing Zinc Finger Transcription Factor ZNF431 Directly Represses Patched1 Transcription. J Biol Chem 286:7279-89 (2011). WB, IP ; Human . Read more (PubMed: 21177534) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab87232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"