Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF441
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human ZNF441 aa 44-89.
    Sequence:

    GMIWQNHDIEEDQYKDLRRNLRCHMVERACEIKDNSQCGGPFTQTQ


    Database link: Q8N8Z8

  • Positive control
    • HEK293T, A549 and PC12 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab200651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 80 kDa.

Target

  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 19 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Zinc finger protein 441 antibody
    • ZN441_HUMAN antibody
    • ZNF441 antibody

Images

  • All lanes : Anti-ZNF441 antibody (ab200651)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : A549 whole cell lysate
    Lane 3 : PC12 whole cell lysate


    Predicted band size : 80 kDa

References

ab200651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up