Overview

  • Product nameAnti-ZNF510 antibody
    See all ZNF510 primary antibodies
  • Description
    Rabbit polyclonal to ZNF510
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 612-661 (KAILSDHQRIHTGEKPFQCNKCGKTFGQKSNLRIHQRTHSGEKSYECNE Y) of Human ZNF510 (NP_055745).

  • Positive control
    • Human fetal heart lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab86312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 10 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • KIAA0972 antibody
    • MGC33740 antibody
    • Zinc finger protein 510 antibody
    • ZN510_HUMAN antibody
    • ZNF510 antibody
    see all

Anti-ZNF510 antibody images

  • Anti-ZNF510 antibody (ab86312) at 1 µg/ml + Fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 79 kDa
    Observed band size : 79 kDa
    Additional bands at : 28 kDa. We are unsure as to the identity of these extra bands.

References for Anti-ZNF510 antibody (ab86312)

ab86312 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"