Overview

  • Product nameAnti-ZNF565 antibody
    See all ZNF565 primary antibodies
  • Description
    Rabbit polyclonal to ZNF565
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 432 - 481 (

    SQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECRECG

    ) of Human ZNF565 (NP_689690)

  • Positive control
    • Fetal kidney lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-ZNF565 antibody images

  • Anti-ZNF565 antibody (ab90012) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal kidney lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 58 kDa

References for Anti-ZNF565 antibody (ab90012)

ab90012 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"