
  • Product name
    Anti-ZNF566 antibody
  • Description
    Rabbit polyclonal to ZNF566
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Cow, Pig, Chimpanzee
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence aa 144-193 (FTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEII H) of human ZNF566 (NP_116227).

  • Positive control
    • Human fetal kidney lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab87781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-ZNF566 antibody images

  • Anti-ZNF566 antibody (ab87781) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size : 49 kDa
    Observed band size : 49 kDa

References for Anti-ZNF566 antibody (ab87781)

ab87781 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87781.
Please use the links above to contact us or submit feedback about this product.


Sign up