Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF569
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 108-157 (

    TEEKGNECQKKFANVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVK

    ) of Human ZNF569 (NP_689697).

  • Positive control
    • HT1080 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94699 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 80 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-ZNF569 antibody (ab94699) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 80 kDa

References

ab94699 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab94699.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up