Overview

  • Product nameAnti-ZNF571 antibody
    See all ZNF571 primary antibodies
  • Description
    Rabbit polyclonal to ZNF571
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 144-193 of Human ZNF571 (

    CRQGFSYLSCLIQHEENHNIEKCSEVKKHRNTFSKKPSYIQHQRIQTGEK

    ) NP_057620.

  • Positive control
    • HeLa whole cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab85844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 17 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ16374 antibody
    • HSPC059 antibody
    • MGC138690 antibody
    • OTTHUMP00000045853 antibody
    • Zinc finger protein 571 antibody
    • ZN571_HUMAN antibody
    • ZNF571 antibody
    see all

Anti-ZNF571 antibody images

  • Anti-ZNF571 antibody (ab85844) at 1 µg/ml + HeLa whole cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 71 kDa
    Observed band size : 71 kDa

References for Anti-ZNF571 antibody (ab85844)

ab85844 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"