Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF583
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Cow, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within internal amino acids 271-320 (

    ECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQIAHLTQHQRIHTGE

    ) of Mouse ZNF583 (NP_001028421).

  • Positive control
    • Mouse Pancreas lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Constituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 66 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-ZNF583 antibody images

  • Anti-ZNF583 antibody (ab122929) at 1 µg/ml + Mouse Pancreas lysate at 10 µg

    Predicted band size : 66 kDa

References for Anti-ZNF583 antibody (ab122929)

ab122929 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up