Overview

  • Product nameAnti-ZNF585B antibody
  • Description
    Rabbit polyclonal to ZNF585B
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 107-156 (RKIIGYKPASSQDQKIYSGEKSYECAEFGKSFTWKSQFKVHLKVPTGEK L) of Human ZNF585B, NP_689492

  • Positive control
    • 721_B cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 88 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceZNF585B may be involved in transcriptional regulation.
  • Cellular localizationNucleus
  • Database links
  • Alternative names
    • DKFZp469O2110 antibody
    • FLJ14928 antibody
    • SZFP41 antibody
    • zinc finger protein 41-like antibody
    • zinc finger protein 41-like protein antibody
    • zinc finger protein 585B antibody
    • ZNF585B antibody
    see all

Anti-ZNF585B antibody images

  • Anti-ZNF585B antibody (ab85640) at 1 µg/ml + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 88 kDa
    Observed band size : 88 kDa
    Additional bands at : 52 kDa. We are unsure as to the identity of these extra bands.

References for Anti-ZNF585B antibody (ab85640)

ab85640 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"