Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF606
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Dog
  • Immunogen

    Synthetic peptide of 14 amino acid residues from the amino terminal region of human ZNF606(WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLD LVQRTLY).

  • Positive control
    • Foetal kidney lysate, (human).

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab42481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 92 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/312500.

Target

  • Function
    May be involved in transcriptional regulation.
  • Tissue specificity
    Expressed in brain.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 16 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ14260 antibody
    • KIAA1852 antibody
    • Zinc finger protein 328 antibody
    • Zinc finger protein 606 antibody
    • ZN606_HUMAN antibody
    • ZNF328 antibody
    • ZNF606 antibody
    see all

Images

  • Anti-ZNF606 antibody (ab42481) at 1 µg/ml + Fetal kidney lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG 1: 50,000 - 100,000

    Predicted band size : 92 kDa
    Observed band size : 82 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 25 kDa (possible cleavage fragment),32 kDa (possible cleavage fragment),75 kDa (possible cleavage fragment).

References

ab42481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab42481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up