Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF606
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Dog
  • Immunogen

    Synthetic peptide of 14 amino acid residues from the amino terminal region of human ZNF606(WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLD LVQRTLY).

  • Positive control
    • Foetal kidney lysate, (human).

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab42481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 92 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/312500.

Target

  • Function
    May be involved in transcriptional regulation.
  • Tissue specificity
    Expressed in brain.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 16 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ14260 antibody
    • KIAA1852 antibody
    • Zinc finger protein 328 antibody
    • Zinc finger protein 606 antibody
    • ZN606_HUMAN antibody
    • ZNF328 antibody
    • ZNF606 antibody
    see all

Anti-ZNF606 antibody images

  • Anti-ZNF606 antibody (ab42481) at 1 µg/ml + Fetal kidney lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG 1: 50,000 - 100,000

    Predicted band size : 92 kDa
    Observed band size : 82 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 25 kDa (possible cleavage fragment),32 kDa (possible cleavage fragment),75 kDa (possible cleavage fragment).

References for Anti-ZNF606 antibody (ab42481)

ab42481 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab42481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up