
  • Product name
    Anti-ZNF625 antibody
  • Description
    Rabbit polyclonal to ZNF625
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 (GERLLESKKDHQHGEILTQVPDDMLKKKTPRVKSCGEVSVGHASLNRHH R) of Human ZNF625 (NP_660276)

  • Positive control
    • human fetal heart lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab87290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-ZNF625 antibody images

  • Anti-ZNF625 antibody (ab87290) at 1 µg/ml + Fetal heart lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 35 kDa
    Observed band size : 38 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 40 kDa. We are unsure as to the identity of these extra bands.

References for Anti-ZNF625 antibody (ab87290)

ab87290 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87290.
Please use the links above to contact us or submit feedback about this product.


Sign up