
  • Product nameAnti-ZNF641 antibody
    See all ZNF641 primary antibodies
  • Description
    Rabbit polyclonal to ZNF641
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 388-437 (RHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRNSWDRGTSV F) of Human ZNF641, NP_689533

  • Positive control
    • HepG2 whole cell lysate



Our Abpromise guarantee covers the use of ab85642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-ZNF641 antibody images

  • Anti-ZNF641 antibody (ab85642) at 1 µg/ml + HepG2 whole cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 50 kDa

References for Anti-ZNF641 antibody (ab85642)

ab85642 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85642.
Please use the links above to contact us or submit feedback about this product.