
  • Product name
    Anti-ZNF641 antibody
  • Description
    Rabbit polyclonal to ZNF641
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 388-437 (RHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRNSWDRGTSV F) of Human ZNF641, NP_689533

  • Positive control
    • HepG2 whole cell lysate



Our Abpromise guarantee covers the use of ab85642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.



  • Anti-ZNF641 antibody (ab85642) at 1 µg/ml + HepG2 whole cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 50 kDa


ab85642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85642.
Please use the links above to contact us or submit feedback about this product.


Sign up