Anti-ZNF671 antibody - C-terminal (ab178362)

Overview

  • Product name
    Anti-ZNF671 antibody - C-terminal
  • Description
    Rabbit polyclonal to ZNF671 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide within Human ZNF671 aa 485-534 (C terminal). The exact sequence is proprietary. (NP_079109)
    Sequence:

    GKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL


    Database link: Q8TAW3

  • Positive control
    • Human uterus tumor lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab178362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 61 kDa.

Target

  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 10 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Zinc finger protein 671 antibody
    • ZN671_HUMAN antibody
    • ZNF671 antibody

Images

  • Anti-ZNF671 antibody - C-terminal (ab178362) at 1 µg/ml + Human uterus tumor lysate at 10 µg

    Predicted band size: 61 kDa

References

ab178362 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up