Overview

  • Product nameAnti-ZNF771 antibody
    See all ZNF771 primary antibodies
  • Description
    Rabbit polyclonal to ZNF771
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (

    VVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRSTLAKHARTH

    ) of Human ZNF771 (NP_057727).

  • Positive control
    • Human fetal thymus nuclear lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceZNF771 may be involved in transcriptional regulation.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • DSC43 antibody
    • Mesenchymal stem cell protein DSC43 antibody
    • Q7L3S4 antibody
    • Zinc finger protein 771 antibody

Anti-ZNF771 antibody images

  • Anti-ZNF771 antibody (ab94789) at 1 µg/ml + Human fetal thymus cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 36 kDa
    Observed band size : 31 kDa (why is the actual band size different from the predicted?)

References for Anti-ZNF771 antibody (ab94789)

ab94789 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"