Overview

  • Product name
    Anti-ZNF771 antibody
  • Description
    Rabbit polyclonal to ZNF771
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (

    VVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRSTLAKHARTH

    ) of Human ZNF771 (NP_057727).

  • Positive control
    • Human fetal thymus nuclear lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    ZNF771 may be involved in transcriptional regulation.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • DSC43 antibody
    • Mesenchymal stem cell protein DSC43 antibody
    • Q7L3S4 antibody
    • Zinc finger protein 771 antibody

Images

  • Anti-ZNF771 antibody (ab94789) at 1 µg/ml + Human fetal thymus cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 36 kDa
    Observed band size : 31 kDa (why is the actual band size different from the predicted?)

References

ab94789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab94789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up