Anti-ZNF774 antibody (ab122137)
Key features and details
- Rabbit polyclonal to ZNF774
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ZNF774 antibody -
Description
Rabbit polyclonal to ZNF774 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
antigen sequence:
MWLGTSGKSGLPGHCLENPLQECHPAQLEEWALKGISRPSVISQPEQKEE PWVLPLQNFEARKIPRESHTDC
, corresponding to amino acids 1-72 of Human ZNF774 -
Positive control
- Human colon tissue; RT4 cell lysate and Human Plasma
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122137 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 1 - 4 µg/ml.
Recommend PFA Fixation and Triton X-100 treatment |
|
WB |
Use a concentration of 0.04 - 0.4 µg/ml.
|
|
IHC-P |
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 1 - 4 µg/ml. Recommend PFA Fixation and Triton X-100 treatment |
WB
Use a concentration of 0.04 - 0.4 µg/ml. |
IHC-P
1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May be involved in transcriptional regulation. -
Sequence similarities
Belongs to the krueppel C2H2-type zinc-finger protein family.
Contains 12 C2H2-type zinc fingers.
Contains 1 KRAB domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 342132 Human
- SwissProt: Q6NX45 Human
- Unigene: 55307 Human
-
Alternative names
- Zinc finger protein 774 antibody
- ZN774_HUMAN antibody
- ZNF774 antibody
Images
-
Immunofluorescent staining of Human cell line A-431 shows positivity in cytoplasm and cytoskeleton (intermediate filaments). Recommended concentration of ab122137 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
ab122137, at 1/200 dilution, staining ZNF774 in Human colon tissue by Immunohistochemistry using formalin-fixed, paraffin-embedded tissue.
-
All lanes : Anti-ZNF774 antibody (ab122137) at 1/500 dilution
Lane 1 : RT4 cell lysate
Lane 2 : U251MG cell lysate
Lane 3 : Human Plasma
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab122137 has not yet been referenced specifically in any publications.