Overview

  • Product nameAnti-ZNF774 antibody
  • Description
    Rabbit polyclonal to ZNF774
  • Tested applicationsSuitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence:

    MWLGTSGKSGLPGHCLENPLQECHPAQLEEWALKGISRPSVISQPEQKEE PWVLPLQNFEARKIPRESHTDC

    , corresponding to amino acids 1-72 of Human ZNF774

  • Positive control
    • Human colon tissue; RT4 cell lysate and Human Plasma

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab122137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

WB 1/250 - 1/500.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 12 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Zinc finger protein 774 antibody
    • ZN774_HUMAN antibody
    • ZNF774 antibody

Anti-ZNF774 antibody images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in cytoplasm and cytoskeleton (intermediate filaments). Recommended concentration of ab122137 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122137, at 1/200 dilution, staining ZNF774 in Human colon tissue by Immunohistochemistry using formalin-fixed, paraffin-embedded tissue.
  • All lanes : Anti-ZNF774 antibody (ab122137) at 1/500 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251MG cell lysate
    Lane 3 : Human Plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

References for Anti-ZNF774 antibody (ab122137)

ab122137 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"