Overview

  • Product nameAnti-ZNF781 antibody
    See all ZNF781 primary antibodies
  • Description
    Rabbit polyclonal to ZNF781
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a regio within N terminal amino acids 1-50 (QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQ H) of Human ZNF781

  • Positive control
    • Fetal muscle lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:312500.

Target

  • RelevanceZNF781 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 4 C2H2-type zinc fingers. ZNF781 may be involved in transcriptional regulation. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • FLJ37549 antibody
    • MGC131783 antibody
    • zinc finger protein 781 antibody

Anti-ZNF781 antibody images

  • Anti-ZNF781 antibody (ab81562) at 1 µg/ml + Fetal Muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 42 kDa
    Observed band size : 38 kDa (why is the actual band size different from the predicted?)

References for Anti-ZNF781 antibody (ab81562)

ab81562 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"