Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF781
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a regio within N terminal amino acids 1-50 (QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQ H) of Human ZNF781

  • Positive control
    • Fetal muscle lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1:312500.

Target

  • Relevance
    ZNF781 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 4 C2H2-type zinc fingers. ZNF781 may be involved in transcriptional regulation. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • FLJ37549 antibody
    • MGC131783 antibody
    • zinc finger protein 781 antibody

Images

  • Anti-ZNF781 antibody (ab81562) at 1 µg/ml + Fetal Muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 42 kDa
    Observed band size : 38 kDa (why is the actual band size different from the predicted?)

References

ab81562 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up