Overview

Description

  • Nature
    Synthetic
  • Amino Acid Sequence
    • Sequence
      RKTALEAHRWIHRSCSERRAWQQAVVGRSEPIPVLGGKDPPVHFRHFPDI
    • Molecular weight
      46 kDa

Associated products

Specifications

Our Abpromise guarantee covers the use of ab113081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-ZNF785 antibody (ab50868)

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituent: 100% dH2O

General Info

  • Alternative names
    • Zinc finger protein 785
    • ZN785_HUMAN
    • ZNF785
  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 7 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References for ZNF785 peptide (ab113081)

ab113081 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up