Overview

  • Product nameAnti-ZNF79 antibody
    See all ZNF79 primary antibodies
  • Description
    Rabbit polyclonal to ZNF79
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region from N terminal amino acids 2-51 (

    LEEGVLPSPGPALPQEENTGEEGMAAGLLTAGPRGSTFFSSVTVAFAQER

    ) of Human ZNF79 (NP_009066)

  • Positive control
    • Jurkat Cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab85592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-ZNF79 antibody images

  • Anti-ZNF79 antibody (ab85592) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat Cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 55 kDa
    Observed band size : 55 kDa
    Additional bands at : <22 kDa. We are unsure as to the identity of these extra bands.

References for Anti-ZNF79 antibody (ab85592)

ab85592 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"