Overview

  • Product nameAnti-ZNF793 antibody
    See all ZNF793 primary antibodies
  • Description
    Rabbit polyclonal to ZNF793
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within amino acids 288-337 (

    CGKAFTQKSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGER

    ) of Human ZNF793 (NP_001013681).

  • Positive control
    • HT1080 nuclear lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-ZNF793 antibody images

  • Anti-ZNF793 antibody (ab90326) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

References for Anti-ZNF793 antibody (ab90326)

ab90326 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"